PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004498126.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 243aa    MW: 28496.5 Da    PI: 7.3477
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004498126.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.72.3e-26959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    kri+n++ rqvtfskRr+g++KK +ELSvLCda++ +iifsstgkl+ yss
  XP_004498126.1  9 KRIQNTTTRQVTFSKRRTGLIKKTHELSVLCDAQIGLIIFSSTGKLFQYSS 59
                    79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.104161IPR002100Transcription factor, MADS-box
CDDcd002654.76E-41278No hitNo description
SuperFamilySSF554553.4E-31282IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-29323IPR002100Transcription factor, MADS-box
PfamPF003192.7E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-293859IPR002100Transcription factor, MADS-box
PfamPF014863.3E-1783169IPR002487Transcription factor, K-box
PROSITE profilePS5129712.54688182IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008360Biological Processregulation of cell shape
GO:0019252Biological Processstarch biosynthetic process
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:2000029Biological Processregulation of proanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MGRGKIEIKR IQNTTTRQVT FSKRRTGLIK KTHELSVLCD AQIGLIIFSS TGKLFQYSSE  60
PYRMDQIIEK YQRSTGKRIM VESDHHYREE MFHDMAMLRQ ESIRVELGIQ RYLGSDMNGL  120
KYDDLTKLEE ELEFSLAKVR NRQNELLSQQ MENLRRKERI LEDEHINLSN WEQRAVMEFH  180
KAAIEANKQQ QNGMDEFAFF EDQPAGTILQ LAAPVLPLHL HPYLQLAQPN IHQDSLPSRD  240
PKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A5e-21271168Myocyte-specific enhancer factor 2A
3kov_B5e-21271168Myocyte-specific enhancer factor 2A
3kov_I5e-21271168Myocyte-specific enhancer factor 2A
3kov_J5e-21271168Myocyte-specific enhancer factor 2A
3p57_A5e-21271168Myocyte-specific enhancer factor 2A
3p57_B5e-21271168Myocyte-specific enhancer factor 2A
3p57_C5e-21271168Myocyte-specific enhancer factor 2A
3p57_D5e-21271168Myocyte-specific enhancer factor 2A
3p57_I5e-21271168Myocyte-specific enhancer factor 2A
3p57_J5e-21271168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004498126.10.0PREDICTED: protein TRANSPARENT TESTA 16
TrEMBLV7C8201e-122V7C820_PHAVU; Uncharacterized protein
STRINGGLYMA20G00401.11e-112(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49352952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.21e-63MIKC_MADS family protein